Protein

MCA_00025_1

Length
190 amino acids

Gene name: BET3

Description: Trafficking protein particle complex subunit BET3

Browser: contigA:67536-68174-

RNA-seq: read pairs 1201, FPKM 77.7, percentile rank 74.8% (100% = highest expression)

Protein function

Annotation:BET3Trafficking protein particle complex subunit BET3
KEGG:K20302TRAPPC3 trafficking protein particle complex subunit 3
EGGNOG:0PK75BET3trafficking protein particle complex subunit 3
SGD closest match:S000001776BET3Trafficking protein particle complex subunit BET3
CGD closest match:CAL0000194939orf19.5817Trafficking protein particle complex subunit BET3

Protein alignments

%idAln lengthE-value
MIA_04060_178.42%1904e-116MIA_04060_1
A0A060TFR6_BLAAD75.26%1907e-113Trafficking protein particle complex subunit BET3 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D25234g PE=3 SV=1
A0A0J9X4T8_GEOCN75.88%1995e-110Trafficking protein particle complex subunit BET3 OS=Geotrichum candidum GN=BN980_GECA03s02254g PE=3 SV=1
Q6CCJ8_YARLI73.16%1902e-108Trafficking protein particle complex subunit BET3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_C08782g PE=3 SV=1
UniRef50_Q6CCJ873.16%1904e-105Trafficking protein particle complex subunit BET3 n=38 Tax=cellular organisms TaxID=131567 RepID=Q6CCJ8_YARLI
A0A1E3PD82_9ASCO66.32%1901e-95Trafficking protein particle complex subunit BET3 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_84498 PE=3 SV=1
A0A1E4TFP0_9ASCO60.85%1896e-89Trafficking protein particle complex subunit BET3 OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_2296 PE=3 SV=1
BET3_YEAST60.32%1899e-83Trafficking protein particle complex subunit BET3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BET3 PE=1 SV=1
A0A1D8PGS6_CANAL59.07%1938e-81Trafficking protein particle complex subunit BET3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.5817 PE=3 SV=1
A0A161HH01_9ASCO77.37%1377e-77TRAPP complex core subunit BET3 OS=Sugiyamaella lignohabitans GN=BET3 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.5124

Protein family membership

Domains and repeats

  1. Domain
1 20 40 60 80 100 120 140 160 180 190

Detailed signature matches

  1. Family IPR007194
    Transport protein particle (TRAPP) component
    1. PF04051 (TRAPP)
  2. Family IPR016721
    Bet3 family
    1. cd14942 (TRAPPC3_bet3)
    2. PIRSF018293 (TRAPP_...)
  3. Domain IPR024096
    NO signalling/Golgi transport ligand-binding domain
    1. SSF111126 (Ligand-b...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. G3DSA:3.30.13...

Residue annotation

  1. TRS31 interface cd...
  2. ligand binding sit...
  3. TRS23 interface cd...
  4. acylation site cd1...

Protein sequence

>MCA_00025_1
MSKALRSVGEDIWKTKVDKINAEIVTLTYGSVVAQLCKDYEGDYIKVNKQLEKMGYNIGLRLIEDYLSRSNLGRCTNFRE
TAEAISKVGFKMFLNTTPTIDNWTPDNKQFSLILDENPLAEFVELPDDGRAHRELWYSNVLVGVIKGACEMVQLEVDSYF
VSDVLQGASTTELRVKFVKLLEDEVPAGED

GO term prediction

Biological Process

GO:0048193 Golgi vesicle transport

Molecular Function

None predicted.

Cellular Component

GO:0030008 TRAPP complex