Protein

MCA_00021_1

Length
80 amino acids


Description: NADH:ubiquinone oxidoreductase, subunit B18 (mitochondrial respiratory complex I)

Browser: contigA:56548-57294+

RNA-seq: read pairs 3710, FPKM 565.9, percentile rank 94.7% (100% = highest expression)

Protein function

Annotation:NADH:ubiquinone oxidoreductase, subunit B18 (mitochondrial respiratory complex I)
KEGG:K03963NDUFB7 NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 7
EGGNOG:0PQX2Nadh-ubiquinone oxidoreductase b18 subunit
CGD closest match:CAL0000188334orf19.446.2Uncharacterized protein

Protein alignments

%idAln lengthE-value
A0A0J9XD72_GEOCN85.00%601e-34NB8M subunit of mitochondrial NADH:ubiquinone oxidoreductase (Complex I), putative OS=Geotrichum candidum GN=BN980_GECA11s01715g PE=4 SV=1
MIA_04064_181.97%612e-33MIA_04064_1
A0A060TB56_BLAAD75.00%608e-30ARAD1D25300p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D25300g PE=4 SV=1
UniRef50_A0A060TB5675.00%602e-26ARAD1D25300p n=10 Tax=Saccharomycetales TaxID=4892 RepID=A0A060TB56_BLAAD
B5FVG1_YARLI62.96%543e-21YALI0E31766p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E31766g PE=4 SV=1
A0A1D8PDI3_CANAL38.60%575e-08Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.446.2 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0329

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

Protein sequence

>MCA_00021_1
MGALKELPPLLSEEEMKKHKLPLPYRDRCSALLVPLNKCRVEGWYLPWNCSHERHIYEECQYLDFKRRVKELAEQKKKDN

GO term prediction

Biological Process

None predicted.

Molecular Function

GO:0003954 NADH dehydrogenase activity
GO:0008137 NADH dehydrogenase (ubiquinone) activity

Cellular Component

GO:0005739 mitochondrion